#HOT PRODUCT

[AlexoTech 한국공식대리점] Amyloid-Beta 4-40 (1.0 mg) Human, Recombinant 제품소개

등록일2024. 07. 17
조회수287
링크 복사하기
[AlexoTech 한국공식대리점] Amyloid-Beta 4-40 (1.0 mg) Human, Recombinant 제품소개

[AlexoTech] Phospho antibodies


어스바이오는 AlexoTech 한국 공식 대리점으로서 모든 제품을 전문적으로 취급 및 공급하고 있습니다.
AlexoTech의 Amyloid-Beta 제품을 소개드립니다.
 

[AlexoTech] Amyloid-Beta 4-40 (1.0 mg) Human, Recombinant

 
Recombinant Human Amyloid-Beta and Variants

Description: Recombinant Amyloid-Beta peptide 4-40, Human
Article no: AB-301-10
Amount: 1mg
Format: Lyophilized
Molecular Weight: 4015 Da
Sequence: FRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Purity: 95% by Chromatography and SDS-PAGE
Counter Ion: Ammonium Acetate
Storage: Store at -20°C upon arrival.
Source: Protein expressed in Escherichia coli.
Solubility:
Alexotech has developed a proprietary technique of preparing highly soluble Amyloid β-peptides.  It is however, of utmost importance to follow our recommendations of solubilisation and to efficiently solubilise the Amyloid β-peptide. The pH should briefly be raised to between 11-12. This can be accomplished by addition of e.g. 20 mM NaOH, however, at higher peptide concentrations a higher concentration of NaOH may be required due to the intrinsic buffering capacity of the peptide. The pH should therefore always be monitored and if necessary adjusted. After solubilisation the pH can be adjusted using a 10X stock solution of the buffer of choice.
 

어스바이오(USBIO)는 AlexoTech 한국 공식 대리점입니다.
해당 제품에 대한 문의나 AlexoTech 제품의 견적 또는 문의사항이 있으시면 아래로 연락주시기 바랍니다.
Tel : 02-862-2816 / email : bio@usbio.co.kr
관련 포스트